PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G289000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 310aa    MW: 33598.2 Da    PI: 6.3704
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G289000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.5e-161865148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  Sevir.5G289000.1.p 18 KGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLQRCGKSCRLRWINYL 65
                        678*******************************************97 PP

2Myb_DNA-binding47.93.1e-1571115147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++ 
  Sevir.5G289000.1.p  71 RGSFSQQEEDAIVGLHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 115
                         899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7251365IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-231468IPR009057Homeodomain-like
SuperFamilySSF466891.42E-2816112IPR009057Homeodomain-like
SMARTSM007172.2E-121767IPR001005SANT/Myb domain
PfamPF002492.1E-141865IPR001005SANT/Myb domain
CDDcd001671.49E-112165No hitNo description
PROSITE profilePS5129424.51766120IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2569120IPR009057Homeodomain-like
SMARTSM007172.2E-1470118IPR001005SANT/Myb domain
PfamPF002491.4E-1371115IPR001005SANT/Myb domain
CDDcd001673.24E-1073113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRHAGSAAA GVQHKLRKGL WSPEEDEKLY NHIIRYGVGC WSSVPKLAGL QRCGKSCRLR  60
WINYLRPDLK RGSFSQQEED AIVGLHEILG NRWSQIASHL PGRTDNEIKN FWNSCLKKKL  120
RQRGIDPSTH KPISANAAAT AAALDQQPAS QEQKPPADAD SGFALKRQHQ QVFDPFPLTD  180
SFGGGFDAAG AALYGHLGGG KQDAGGFVDY SSVLDVSENL GYGESSSNSS NWNCAPEASN  240
ALDGGDAPLH WASESKAVEP FAGYGGGEEQ SLEHKFMLPC HGQQEQSLPH FDFDISRGAV  300
VGEFNLEFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28161205108B-MYB
1h8a_C7e-281612025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115121LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969673.10.0PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-110MYB3_HORVU; Myb-related protein Hv33
TrEMBLK3XUE10.0K3XUE1_SETIT; Uncharacterized protein
STRINGSi005548m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-75myb domain protein 86